Click Here To Go To The Hourly Updated Galleries

 

 
 

Ranch Whores Girls with animals

 
 
Ranch Whores, hot ranch action, see the big sex orgies on the ranch of love, these horny girls simply loves big cocks and suck and fuck them all night !
 
CLICK HERE TO ENTER RANCH WHORES
 

Dogfucking Movies The biggest archive of dogsex films

Alice new star the hottest young girl in animalsex

OTHER HIGH QUALITY FREE SITES WITH ANIMALSEX GIRLS

ANIMAL SEX MOVIES ANIMALSEX TALES TOY SLUTS BEAST CANDY
BEAST BOOST ANIMAL SEX FUCKERS ANIMALBOSS BEAST BLOW
BEASTIALITY PIX BEAST AGENT BEASTY WORLD ANIMAL WHOREHOUSE
THUMB ALA CARTE MYSIK'S ANIMALSEX ZOO X 3 FARM TEEN GIRLS
BANNED BEAST WIFE XPOSED HOT CHICKS PICS FETISH SEX NETWORK
FARM TEEN GALLERIES FETISH DEVIL EU BESTIALITY HORZY TGP
ILLEGAL RAPES TGP ANIMALSEX FANTASIES ANIMAL SEX FUCKERS BLOW MY PENIS
ANIMALSEX BABES BIZARRE BOSS BEAST-O-RAMA PORN MOBSTERS
THE PIGFILES BESTIALITY LINKS AMATEUR MOVIES TGP BIZARRE X 3
BIZAR DREAMS BESTIALITY TGP FUCK STUDENTS SEX ON THE LIMIT
BEAST-O-RAMA TGP ANIMALSEX ANIMAL SEX LINKS WE LICK HORSES
BIZARRE BOSS TGP ANIMALSEX GALLERIES FREE ZOO SEX WET ZOO SEX
HORSE SEX GALLERIES DOG FUCKING SEX HORSESEX.NAME FORCED WITNESS TGP
ONLINE MOVIE SEX FREE FETISH SEX BIZAR MOLLY ZOO SEX FUCKERS
RAPEBOSS TGP DOG FUCKING SEX BIZAR GIRLS HORSE SEX FUCKERS
WE LIKE HORSES ANIMALSEX TGP PORN MOBSTERS TGP BESTIALIST
AMATEUR KINKY SLUTS BESTIALIST TGP ANIMALBOSS TGP THUMBNAIL TGP
HORSESEX GALLERIES PORNBOSS ZOOPHILIA SEX PORNGANGSTER
BIZAR ARCHIVE ANIMALSEX NETWORK ZOO SEX LINKS BIZAR CHICKS
FREE SEX GALLERIES SEX SITES REVIEWS SITEMAP  

Alice new star the hottest young girl in animalsex

ADULT TOPLIST'S (EXTREME ACTION)
 
CLICK HERE FOR EXTREME ILLEGAL PORN
 
INCEST STORIES - Incest stories, movies & pix
 

Alice new star the hottest young girl in animalsex

Asian Bestiality - Extreme sex movies from the east

Asian babe and huge rottweiler fuck

Horny girl penetrated by dog cock on couch

Doggy is hardcore fucking girls ass hole

Alice showing you extreme animalsex

Charming gisele enjoys her big stallion penis

Sexy and horny girl with very slutty horse

Giant throbbing dog cock squeezed in her butt

Private leticia  beast orgies with a dog

She licks the hot fresh dogcum of the dog cock

Johns horny dog lick and fucks an amateur girl

Horseporn Movies - See the hot girls fucking giant horsecocks

THE HUGE LIST OF THE BEST ANIMALSEX SITES TODAY

FARM IDOLS ANIMAL EROTIC JP TABOO BEASTY HEAVEN
ALICE NEW STAR BEAST ASIA MOVIES DOG VIDEO CLUB HORSEPORN MOVIES
FUCKED BY ANIMALS CUM FROM ANIMALS HORSES AND TEENGIRLS BESTIALITY COUPLES
BEAST MALE BEAST AVS CLUB CRAZY TOON HEROES HORSE VIDEO CLUB
EXTREME AVS CLUB ANIMAL ASSFUCKING BEAST DEBUTANTS BEAST CUMSHOTS
BESTIALITY HUMPING PAOLA XXX BESTIALITY SEXTOONS FUCKED BY HORSES
BEASTY CUM BESTIALITY DRAWINGS BESTIALITY FACIALS BESTIALITY GIRL
BRAZIL BESTIALITY DR. BESTIALITY FARMSEX LOVERS WILD HORSESEX
ANIMAL CUMMERS ANIMALSEX BRAZIL ANAL AND BESTIALITY BEAST AMATEURS
STALLION MOVIES BRAZILIAN ZOO DOGPORN MOVIES K9 SLUTS
HORSE LOVING ANIMALSEX LOVERS BRAZIL HORSELOVERS HORSE BLOWING
ANAL DOGMOVIES ZOOSEX EXOTIC RETRO ZOOSEX BESTIALITY LOVING
ZOO MOVIES ZOO HUNGER THE BEAST A VISTA BEASTY ORGIES
ZOO IN BRAZIL FARM GAYS ZOO FEVER STALLION CUM
TOKYO BESTIALITY FARM XXX MOVIES LESBO BESTIALITY MALE ZOOPHILIA
CAMILLA XXX     BESTIALITY COCKTAILS

Dogfucking Movies The biggest archive of dogsex films

TODAY'S FREE ANIMAL STORY
"Anna Revisits Marineland" The next summer after her experience at Marineland, Anna was back in Florida enjoying her time off from Tennis. After mating with dolphins and getting double teamed by Bill and Richard over at Marineland, she couldn't get over what happened that day. Her mind was often drifting away, thinking, fantasizing about that unique and strange experience even though at times, she wasn't sure if she liked it or not. It kind of scared her, but every time she thought about that day, passion was filling her loins. The famous tennis player had never told anyone, keeping that day to herself as so many things in her life was always so public, and besides, who could you tell! It was mid July, humid, and really hot...It was right after Wimbledon, and Anna was kind of missing playing tennis. The popular tennis girl was alone at home, with only a few "servants" that were almost all leaving now, as it was getting late in the afternoon on this steamy Sunday. Most of them had the remaining of the day off and the tennis star was getting kind of bored. Usually so busy with multiple photo shoots, publics appearances, endless promos and stuff, she had some free time on her hands. After thinking about it, she decided to go hit a few balls on the new courts she had built in her backyard. Anna really missed playing tennis, but was sick of the pressure and ridicule from the media. Inspired by the last tournament she watched on TV(Wimbledon), she decided to wear white for her practice session. Anna then went in her walkin closet, put on some white shorts, and a white sports bra with a white Tshirt. Looking at herself in the mirror, the sexy racket wielder noticed that she forgot to braid her hair; which she immediately started doing of course... The inspired tennis girl then went outside, and headed towards her private tennis courts. Exiting her home, she could feel the rush from the wave of heat piercing through her exposed skin as she went through the vale of torrid humid air. It was the end of the day and everything had been baking in the sun all afternoon. The wind was absent, giving you no chance to cool off, but perfect for playing tennis. Being born in cool Moscow Russia, Anna always really enjoyed the warmer climates... Grabbing her tennis racket, she paced on towards what she had in mind. Her machine that shots balls was already set up so all she needed to do is go get some balls in the utility shed. Back on the court, Anna began to do some warm up exercises with some mandatory stretching; especially paying attention to her lower back area as she was having problems with it the last few years. Just as she started, the stretching athlete waved high to the boy named Steve that was passing by on the lawn mower tractor. Steve was employed to do maintenance around the house, mainly yard stuff. He was only seventeen and was making good money working over at Miss Kournikova's estate saving up for his studies. And besides, which young seventeen year old kid wouldn't want to be over at her home! The famous tennis player continued on with some more stretching after doing a few laps around the court. Steve made sure he would pass by again as he couldn't get enough of watching her. Just as he passed by, Anna was bending over, arching her back, extending her hamstrings, showing off her great long toned athletic legs, and not to forget her great firm round ass. What a sight... The young man was totally dazed from watching the tennis star's beautiful silhouette contorting in all these revealing positions. He could already feel his heart beat stronger from watching her like this as suddenly, "VRAAAAACCK!!!!", his tractor hit something! All surprised, the famous tennis girl quickly turned around and looked at the poor boy. After examining the scene, she kind of guessed what happened and couldn't help but break out a cute little laugh. She looked at him and said: "Look where you're going there Steve, don't hurt yourself!", still giggling away. Steve was embarrassed and managed to poorly shout: "Sorry!", with a shy non confident voice. The tractor had hit a rock, stalled and wouldn't start again. Meanwhile, Anna began hitting some balls on the court, trying to get into the rhythm of things. The humiliated young man was trying to figure out what was wrong with the tractor while listening to her hitting balls. The poor teenager was having a real hard time concentrating on anything as he was still trying to recover from that embarrassing moment. After ten minutes, the warmed up tennis girl went over at the shooting machine to set it up on high. It was torridly hot outside and she was already sweating big time. Her little white Tshirt was already all drenched in sweat. The young voyeur was looking over as she was strutting a little closer by, noticing her nipples poking through the wet material. The hot and sweaty tennis girl gave him a look with her beautiful glancing blue/green eyes, and gave him a faint smile. Steve did nothing but stare... She then grabbed the bottom of her soaked Tshirt and took it off to get a little more comfortable in this 105 degrees heat. The young boy couldn't help but stare again, as she removed it in front of him. It was like in slow motion as he had anticipated and hoped for Anna to take that damn shirt off. He looked at the blonde tennis girl's beautiful shaped back covered in sweat as it was curving around while she pulled the fabric over her head to reveal a white sports bra, hugging tightly to her torso. Anna's perfect round behind was now more exposed as well, as it was no longer hidden by the loose baggy clothing apparel she had just removed. The famous tennis player has always been known for her terrific body, and especially for that nice and firm shaped little butt. The staring young man couldn't help watching her beautiful ass dance as she started to walk away, soliciting her toned thigh muscles on every footstep while heading back towards the end of the court to resume her hitting. Steve tried to snap out of it and tried to continue fixing the damn tractor. That broken thing was almost starting now but he was losing concentration again as he could hear his fantasy creature starting to grunt while she was beginning to hit the balls harder and harder on court. Failing to concentrate, the teenager looked up again, and watched as the energized tennis girl practiced her stuff. With Anna only wearing her sports bra now, Steve could just imagine the real shape of her breasts as they were firmly bouncing up and down between each hits. After gazing for little while, the peeping tom went back to business and tried to fix the damn tractor before he would start to get a hard on and get in trouble! After about forty minutes of this, the tennis girl took a break and opened up a big bottle of cold water to cool off. After taking a few sips, she put her head up, closed her eyes, opened her mouth and emptied it all over her. Steve watched as the sparkling liquid was trickling down her hair, face, mouth, and chest area, onwards to her belly and then bouncing off the edge of her shorts. The water and Steve's eyes were following every sexy curve of her body as the cold liquid came into contact with her hot skin making her nipples become real hard from the sudden coldness of the water. Anna shook her head from the shivering effect and blew a little water out her mouth as her lips had parted slightly from the enjoyment of the cooling sensation. With the sun low on the horizon behind her, he noticed the aura of moisture made up of water and sweat it had created, as the mist drizzled back over her body. Catching her breath, the soaked tennis girl took a towel off a chair, wiped her face and hung it on her shoulder and began walking over towards her lawn boy to see what was happening with his mowing machine. "Hey there Steve, is that thing broken or what?", asked the inquisitive tennis girl... Steve looked up(cause he was kneeling on the grass) at Anna standing beside him all covered in moisture, as his eyes went up her stunning athletic body, then stared at those beautiful bluegreen eyes that were looking at him. Even after sweating like this, the Russian tennis girl had the sweetest unique body odor which he could smell now cause, she was standing right next to him. From one to ten on the olfactory turnon scale, the one standing there was a twelve! "Hello! Anybody home?", said the smiling Anna, waving the bottle of water with her right hand in front of the dazed one's face... "Oh! Hum, well, I'm not sure if I found the problem or not... I think the blade is bent preventing the motor from starting up again... Or maybe a gear is broken inside or something, I'm not a real good mechanic. I just can't make it start again...I'm sorry if I broke..." "Don't worry about it, we'll have it fixed.", she replied, quickly cutting him off. The sweaty little Anna was about to turn away and looked back at him and asked: "Steve, are you good with massages? My masseuse isn't here and my back is killing me...", as she pressed her left hand against her hurting lower back..."Bah, no matter, leave that busted thing and follow me." She started to walk away as the easily persuaded young man quickly got up to follow her, while his heart began to race. "You know...", she said. "I think we're the only two people left here today." He didn't say a word as they went over by the pool area. "Go wash up your hands, I'll go get the massage table and stuff." "Okay...", replied the nervous Steve... Without delay, he quickly went inside towards the nearest sink to clean the dirt off his hands. As he washed up, he started to splash some water on his face to calm down, thinking about him being at Anna Kournikova's estate now alone with her, about to give her a massage! He then wiped his face and walked back outside to see the blonde tennis star standing there. She had taken her shoes and socks off, untied her braid and made a quick pony tail. Seeing him coming back, she turned her back to him and removed her shorts and sports bra then laid down on the table hiding her breasts with one hand, face first. She was now wearing only some kind of white cotton victoria secret underwear. The young man tried to swallow, shaking from nervousness, as he glanced at Anna's golden body stretched out on a table before him. He was thinking, "Oh my god! She's so hot! This can't be happening! MUST NOT GET AROUSED!" Breaking his chain of thought, she turned her head towards him with a grin and said: "Come on handsome, don't be shy... I don't bite..." "Okay Miss Kournikova..", replied the nervous boy... "Steve, could you just call me Anna?... I'm sick of hearing Miss Kournikova all the time." "Okay Anna...", with a nervous laugh... That somewhat took away some tension off for Steve. The nervous young man got closer and after hesitating for a brief moment, laid his hands on her beautiful bare body and began rubbing the famous tennis player's naked back. Her skin felt so soft and so warm from hitting balls for near an hour on that hot evening. He was amazed how toned her athletic body felt as he started to work his thumbs in her back, then up her neck area... "Now that feels soooo gooood...", said the now submissive tennis star. The teenager couldn't believe he was giving Anna Kournikova a massage! Steve's hands slowly started to get the hang of it as he was getting a little more relaxed. He carefully paid attention to her hands & forearms, arms & shoulders, not needing any oil or lotion as her bare body was still wet from her little practice session. He could feel the tension all over her stiff warm body as he tried to ease the stress. "Could you do my lower back please? It's killing me...", asked the hurting tennis girl... "Sure..." He rubbed her beautiful soft skin as best he could while her back was beginning to dry out from all the intense stroking of her lovely curvaceous body. "Steve, I brought my bag over... There should be oil in there..." Opening the big Adidas bag, he started to look for a bottle or a tube of some kind. There was all kinds off stuff in there. His explorative hands then fell on a big long blue tube thing, kind of curved up. The intrigued young man paused for a moment, wondering what it could be... It was the dolphin dildo that Bill and Richard had sent Anna after the dolphin experience she had over at Marineland. The secretive tennis girl had kept it and became very fond of it as she was often fantasizing about that day. The tennis star often masturbated herself with that thing, sometimes even watching herself in the video they also sent her. This toy had a very particular way of caressing her insides making the tool very enjoyable. Before he could manage to guess what it was, Anna noticed him grabbing that sex thing... She quickly shouted: "NO!NO!NO! Not that zipper! Try the pocket in front!" "Oh I'm sorry..." "Don't worry about it sweetie...", as she giggled..."I just wanted you to open up the right pocket before you get lost in all my junk in there...", carefully trying to avoid the subject of the true identity of the foreign object... The searching young man finally found what he was looking for, opened the bottle, poured some massage oil in his hands and started to apply the lubricant on her back, resuming his work. The blushing tennis star began giggling again, thinking of what the poor kid had put his hands on just a minute ago. She was wondering if he knew what he had carelessly found. He looked at her a face and noticed that she was still smiling with a funny expression on her face. "What's so funny?", the curious boy asked... Anna laughed out again and replied: "Oh nothing... ha ha! Just thinking... You may continue your work master masseur...", still giggling... "Okaaaay...", he replied, not wanting to pry... She took a deep breath and tried to relax as he began massaging her back again. Steve then started to go down lower on Anna's back as she asked him to. His hands were now gliding over her stunning slippery body. It really felt good... Going up and down with long strokes, taking advantage of the slippery proprieties of the massage oil, he could hear his massage patient making faint vocal expressions as he applied a little more pressure on her muscular back features. She was clearly enjoying this and was beginning to relax...The young man kept looking at the tanned Russian's beautiful backside, noticing the little golden hairs on parts of her back glowing in the sunlight. The sun was setting, giving her body the most exotic color. Though, the mischievous tennis girl was still thinking about that dolphin dildo that was in her bag, mixed with the caressing of her bare body, it was making her have some horny thoughts but tried to keep herself under control. "Steve, could you go down lower please?...", the young man obliged as he observed her famous tattoo which he started to rub, then went down lower near the edge of her panty line. "Ow, oh, Aaah right there... ow...oh, that feels good...", as she squirmed around a little from the pain mixed with soothing relief... Just as she said that, the half aroused teenager couldn't help but get turned on more. Hearing the famous tennis star complain and moan like this was very thoughtprovoking, and slowly his member was dilating in his shorts. His eyes were glued to the compliant girl's body, reflecting the light of the setting sun, as he stroked the bends of her curved lower back area. Anna's head was turned on the same side of the table as he was, and she could clearly see his dick lengthening in his shorts. On this day, the famous tennis player didn't mind, in fact, she felt kind of flattered. Besides, it looked like a pretty nice erection too. While watching the bulge in his pants growing from the affluence of blood to his rising member, she couldn't help it but to get a little aroused herself. The observing tennis girl was having more dirty thoughts. Just the idea of watching a penis inflate from the aura of "her" sexual femininity, with a clear and obvious desire to copulate with her, was releasing hormones of the sex kind through her blood stream. She kept watching the boy's hard on getting bigger by the minute and then said: "While you're at it, could you do my legs as well?", trying to let go of this overcoming feeling... "Sure thing...", answering in a more confident voice... The stirred up young man's hands went up and down Anna's beautiful strong legs one by one finishing with her upper leg area. Steve could feel the firmness of her sturdy thighs, pressing his warm hands strongly, squeezing the blood and stress up her soft toned legs. As he was doing that, he had to part her legs a little and noticed that her white panties were a little wet right where her pussy was. He could clearly see the shape of her sex through the fabric as it hugged to her feminine parts. He wondered if it was from sweat or arousal, as the little thin underwear produced an amazing picturesque camel toe. Caressing her legs like that while looking at the defenseless girl's private parts turned him on even more. Her long athletic legs felt so good, so smooth yet unwavering to the touch. After a while, the half aroused tennis player put her hands down and lowered her underwear just a little. "My back still hurts...", said the instigative Anna ... Steve didn't say a word and went back near on the side of the front end of the massage table to get a good angle on her lower back area. He began to mix caressing and rubbing as his hands went over her tattoo again. He watched as her ass cheeks jiggled while he was rubbing her down. His hard on was now getting a lot bigger and Anna kept looking at it as she was starting to get turned on more and more herself... Her vocal expressions were almost with each rub now, almost like faint moans. Watching at her lowered underwear, young Steve could even see the beginning of her ass crack. Talk about a turn on! He stared at it as he was planning his next move. After a few minutes, without thinking, the courageous young man took his hands, went under the fabric and started to rub her round rear end. Much to his pleasure, the violated tennis girl didn't say a thing expect for her continued vocal pleasure expressions. While enjoying her little massage, Anna just curiously wanted to see how big and hard with desire his erection would get as she was willingly letting herself be fondled by a young seventeen year old horny teenager. Steve couldn't believe that he was grabbing Anna Kournikova's ass! And it felt sooo great! Her soft and silky behind felt so firm, so perfectly round... Doing this, her underwear was lifting up and he could see the blonde tennis star's bare buttocks. As the excited masseur continued fondling her gloriouslooking butt, he pulled on her ass cheeks and managed to see her ass hole which looked like it had never been used. At that point, Steve's dick was pointing high noon! He then went back to her lower back area then and back to her firm ass again, pushing her underwear off more and more each pass. The spying Anna kept observing the young boy's dick in his shorts completely inflated up to maximum now, as it was starting to throb on each one of his heartbeats. Some wild feeling had taken over her, demanding more as his very eyepleasing erection accidentally brushed against her tanned forearm. The contact of his hardened penis while having her ass grabbed made the temperature inside her tunnel of love increase to a boiling point. The juices had started to flow and her hidden erect nipples were trying to dig a hole through the vinyl material of the massage table. The sexually possessed tennis star then parted her legs a bit and started to squirm on the table, rising her fondled bum a little to give him a better angle. She was being aroused by his manipulations and long throbbing erection, declaring its sexual desire, still only a short distance from her face, while the young teenager kept grabbing and fondling her sensitive butt. Steve was getting sexually possessed himself, he wanted to see more. He continued on to what he was hoping for, and then there it was... As the underwear unstuck from her private parts, he finally saw Anna's glorious tightlooking pussy. On his eighth pass, he could clearly see her perfect pink little slit slightly covered with a little moisture as he pulled her underwear down right below the tennis star's ass cheeks. He felt like going there so bad but was still afraid of her reaction even though she didn't say anything now that her round behind was exposed. Keeping her vocal expressions of pleasure every other pass was all she did, or was it... All this time, she was still watching the horny teenager's throbbing penis only a few inches from her pouting lips, still unknowingly(to Steve) brushing against her approaching forearm, as she wanted to feel his manly hardness press against her flesh. The evidence of a little round wet spot in his shorts could easily be noticed. Running the little nails he had over the Russian tennis player's exposed buns, then going up her back, he observed the victim of his manipulations getting goose bumps all over. Noticing the physical reaction of his subject, he did it a few more times to try and tease the gorgeous young woman. He went back down to her voluptuous rear end, and grabbed it really firmly this time. As he squeezed her beautiful buttocks, he heard Anna express herself vocally: "Ooooooh....", as she began to breathe a little deeper... Steve's heart was really racing! Looking at her laid out on the table, breathing harder, with the elastic of her half pulled off panties being stretched by her powerful thighs, he was beginning to realize that the famous tennis star was really turned on! In an instant, Anna then pulled her underwear down near her knees while she squirmed around on the table not sure about her position, wanting more! She gave a look towards the surprised young man with a cool stare and said: "Just take'em off sweetie...". It didn't take too long and the young teenager pulled her panties off leaving the famous tennis star totally naked. "Oh my god!", was thinking Steve... "Could it be more obvious? Do something! There is Anna Kournikova, naked on massage table before me, and I can do anything to her body!" Starting to massage her left thigh, especially concentrating on the inner part, the thrilled young man watched as the famous tennis player parted her legs, and lifted her exposed behind a little more, giving him a clear view and access to her fantastic looking uncovered pussy. Steve couldn't believe this was happening! He pressed on with the rubbing of both of her thighs, as he grabbed her ass on each pass. On each stroke, he would open her ass cheeks more and more, still hesitating on doing what he really wanted to do, unknowingly teasing her more in the process. As he pulled on her soft skin, trying to open up her genital area, he looked at her pink vulva, all nicely trimmed, so cute and tight. Finally, reaching with his thumbs, the anxious young man pulled on each side of her genital area, slowly opening up her precious looking vagina in the process. Anna was wet! The inside of her pussy was so perfect! Finally, he took one of his finger and gently started going up and down her pussy lips, slowly parting them watching for her reaction. Jerking her ass back towards his finger, she was clearly excited, and wanting more. The exploring young man then finally took the tip of is finger and started to insert it inside her vagina, which was all wet from arousal, deeper on each stroke then twisting it a little to get some lubrication on his digit. The aroused Russian tennis girl began to moan from pleasure, the many nerve endings of her insides screaming enjoyment... Taking his finger out, he started to caress her small pink clitoris very gently up and down, then began a slight circular motion, gently pressing on the most sensitive part of her body against her pubic bone. The masturbated tennis star was breathing really heavy, kind of moaning with every other breath. She was so turned on now! Steve then went back to insert his digit inside her genitals stroking her insides. The interior of her vaginal walls felt smoother then anything he had felt before. The horny tennis girl then turned her head quickly to one side to watch him going at it, tossing her beautiful golden blonde pony tail across her arched back. Inserting a second finger inside her snug slit, he could hear her vocally react again. "Oooooh...", as he started to invade her privates with his digits. Anna closed her eyes as she felt him completely inserting his index and middle finger deep inside her. Her vulva felt so tight around his fingers as he slowly fucked her vagina with his digits, feeling all around the contours of her awesome love tunnel. The young man then bent down, and started to gently kiss the middle of her back, going down with each little kiss. As his lips touched the tennis star's skin, the young man's thoughts went overboard by the enticing smell of her hot and silky smooth body. After kissing her tattoo, he continued down lower and gave Anna's prickly little golden hairs area(just above her ass crack) a wet kiss, tasting the sexually aroused girl's skin and sweat in the process. She tasted as enticing as her smell... The excited teenager then held her ass cheeks apart, looking at her perfect little wet opening, and dove in, parting her pussy lips with his oral tool. Boy did she ever taste good! The horny young boy was eating the permissive tennis star out now, probing deep inside her vagina with his tongue. The oral pleasing teenager tasted all the love juices that her glorious blonddecorated vagina had to offer, carefully lapping every drop and swallowing every bit. He stopped, and started to rub her clitoris again making her moan from pleasure. She could feel the electrifying sensations of his middle finger right against her magic spot run through her entire body. Steve then parted her cheeks out and ran his tongue along Anna's ass crack, going over her anus... Noticing the clenching reaction from his tongue running over her highly sensitive sphincter area, he made sure to tease that spot again. She kept moaning and breathing hard then got her head up and said: "Steve, get that blue thing from my bag...please...", as she looked at him, a little out of breath... The sexedup Anna was still thinking about that dildo, wanting the horny teenager to use it on her. He was quick to understand, opened up her bag and took the blue thing out on which he had laid his hands on earlier. It was about two inches around, kind of oval shaped, and about eight inches long. It was designed with a slight and clear S shape along its length with a very pointy kind of tip. The tennis star remained on her stomach and held on to the table, wanting him to use the dolphin device on her so badly. The dildo wielder went down her spine with the toy, going towards her privates while the impatient tennis girl put her face in the towel preparing to receive intense pleasure. Surprised at how tight her body became from the anticipation of the moment, he was thinking that she must surely like that blue thing a whole lot! And in deed she did... The blue probe dragged over her skin, getting lower, skipping a little as the rubbery material was not yet lubricated. Steve then took the tool and started to part her pussy lips a little with its pointy tip. Doing that, he slowly started inserting it inside Anna's tight vagina, bit by bit, getting her natural body lubrication on it. He was amazed at how well it was penetrating her vulva. "Oooh... Oh yeah...", exclaimed the blonde tennis girl. Only a few inches just before the first S curve was going in, and she was already shouting out some load moans! She turned her head to the side to watch him begin penetrating her with the long blue dildo. After a few strokes, Steve dug inside her past the first curve of the rubbery member, making Anna's eyes roll back and close from the pleasure while her mouth opened up and began gasping for air. Putting an elbow on the side of the massage table, with his left hand on her left buttock, he could rest and get a close up view of her vagina starting to stretch around the big blue toy he was inserting into her. All flamed up, the tennis girl's left hand came down and grabbed Steve's left wrist tightly as he kept going deeper and deeper inside her. The dildo wasn't opaque, it was somewhat translucent; he could see through it somewhat and observe the inside of the her beautiful pink vagina as he began thrusting it inside her. It was such a pretty sight, her pussy was tight but was starting to loosen up a little from the back and forth motion. "Aaaaaah!", loudly exclaimed Anna in total pleasure, making the sexiest frowning face. Holding the toy tightly, still holding on to her ass cheek, he began fucking her pussy with long and strong strokes as he watched juice from her intensely aroused vagina covering the dildo more and more... The ablaze tennis star let go of his wrist and tightly grabbed the towel where her face was resting, biting into it from excitement. What the young man didn't know is that the shape of this tool is unique in a very special way. The curvature of the sexual toy presses against the insides of a woman's pussy walls in a way that the bottom and/or top of the S curve vigorously rubs against a woman's Gspot, giving her ultimate pleasure! He kept going at it as his willing victim was grunting and moaning in excitement! On each stroke, the curious boy observed the stretching and contorting of the lips of her vulva around the blue dolphin sex toy, as her love hole was being opened up by the animal's sexual organ replica. The base is also a lot wider then the tip so he could also see her slit being widened by the blue tool each time he drove it deeper inside the wanting tennis girl's pussy. "Aaah!... Aaah!...", the moaning Anna went. Attentively manipulating the sex toy, Steve was making her jolt from delight as he began shoving the dildo all the way inside her on each thrust. The Russian tennis girl was on cloud nine, savoring the intense feeling of the curved toy's friction over her ever so sensitive Gspot. With the deep penetration of the blue probe, she was contracting her walls in pleasure as the tip was almost pressing against the end of her vaginal passage. The feeling of intrusion from this tool was bringing her back to the Marineland experience. The now almost screaming tennis star could vividly remember the dolphins desecrating her bestial virginity a year ago, and she was loving it! After about a few minutes, her pussy started to feel loose as her moanings got closer and closer together while the teenager was going faster. The beautiful Anna was about to climax... "Ooh!... Ooh!... Ooooooh!!!...", she moaned, clenching her fists on the towel... In and out, in and out Steve kept going at it with his vaginal intrusion, while starting to feel some restraint from her Russian vaginal walls. The famous tennis star had started to come and the dildo wielder did his best to keep his pace, forcing the tool inside her, making sure it was going all the way in on each thrust. The Russian star was about to come and Steve had a first row seat! He kept going in and out, in and out, thrusting the dildo all the way inside her until she couldn't hold it any longer. "Oooh...Oooh Steve...", the tennis star began to come, because of the semi transparency of the tool, he could see her clenching vagina constricting around the dildo. Love juice began to flow all around the tool, exiting her filled pussy and drooling on the table as she was having one huge intense orgasm. "Aaah!... aaah!... aaaaaaaah!", cried out Anna loudly, as she reached orgasmic Nirvana... The tightening of her contractions were so intense that she almost jammed the tool to a stop! Wow! Steve thought, this thing really works good! As the tennis star finished coming, he gradually slowed his pace to let her recover and catch her breath. He looked around not too sure if anyone heard her cries of joy, as her body shook a few more times from the violent orgasm. Remembering the candid pictures taken by paparazzi a few years ago in her back yard, the young man looked around to see if there could be someone hiding with a camera that could take advantage of the exposed Russian tennis girl. The unworried Anna casually turned on her side, then onto her back with the dildo still inside her, looked at Steve with a smile, parting her beautiful hair from her face... "Now that was good...", as she slowly took it out ... Anna was covered in sweat, all relaxed and looked so beautiful after coming like this. For some reason, she was totally untroubled by being vulnerably naked outside like this. Did she care? Lost in the moment? Or did she just wanted to be seen???, wondered Steve... "You wanna to know what that thing is?", she asked... "Well, to be honest, I would have to say, It looks like a dolphin's penis..." "What? Wow! How do you know that?", quickly replying... "It is? I thought I recognized the shape. I started a student job at Marineland lately and I am studying marine biology... The dolphins often have erections while swimming around the pool. They are very social and sexual creatures. And it really does look like one..." "You're kidding!!!" "No I'm serious...", replied Steve with a smile... "Oh my god!", she laughed..."This is too funny!...So you want to become a marine biologist or something? You want to save the dolphins?", asked the inquisitive girl... "I want to help save all our oceans, we're destroying this planet and somebody has to do something about it...pathetic huh?" "No way! How cute... how nice... Makes my life style look like crap really...Wait... do you still work there?" "Yep...", he answered. "Hum...If you knew what it was, didn't it bother you?" "Not really, it's just a toy after all... You're so beautiful Anna...", said the enamored young man as he caressed one of her lovely toned thighs, changing the subject, completely dazed by her beauty... Anna blushed and giggled... "You're so cute...", she said smiling and caressing his arm..."Do you have access to the site and stuff?" "Yeah, I even have the keys cause I do the dirty work when the area is closed off to the public... I also have to feed the animals on the odd hours sometimes..." "What are we waiting for, let's go there!" "Huh? What? Now? Seriously?", as he looked at the smiling tennis star that was nodding in agreement..."No... I couldn't do that! I'll get in trouble!" "Come on... It's me...We won't break anything!", laying there with her bare gorgeous body exposed, half sitting up now... "Well it's hum... well... you know...It's not that simple...I need this and..." Anna whispered into his hear:"I could let you make love to me in the pool...", as she then looked at him with a sexy smile. The Russian star then grabbed his hand and put it on the dildo and slowly shoved it inside her and started to pull it in and out at a very slow pace. Steve did not manage to relieve himself and was still turned on by the opportunity. Hey It's Anna !!! "Come on Steve...", said the persuasive girl in a soft voice as she was beginning to fuck herself with the dildo again with the teenager's hand still on it. The famous tennis girl had a small dark blonde triangle above her fantastic looking love mound as the curious boy couldn't help but look down to watch her penetrate herself with the blue toy. She started breathing heavier again while looking at him watching between her legs while her hand remained on top of his, guiding the dildo within. She then bent down, and kissed him softly on the lips. To Steve's ignorance, he accidentally hit a very small button on the base of the toy as it started to intensely vibrate! "Ooohh!!!", immediately exclaimed the surprised tennis star... Anna's abdominal muscles squeezed and contracted real hard as she was being overtaken by sudden sensations..."Oh my god!", said Anna as her abdomen heaved rapidly as she breathed deep. She tried to pull the dildo out as fast as she could. "Oooh! Oooh! ....", as she finally managed to pull out the dildo, almost coming on the spot as it vibrated right on her Gspot and all over inside her! She looked at the toy, found the button, and turned it off. The blonde tennis girl caught her breath and started laughing hysterically... "What the hell? That thing has vibrating mode?" Anna still laughing: "Ha ha ha!... You should of seen the look upon your face! It's very sensitive down there after you have an orgasm you know!" Steve smiled and started laughing as well saying:"I'm sorry Anna..." She was still laughing, "Come on.... let's go ! Pretty please!!!" "Okay, okay... we'll go..." "Good boy!", she replied with a mocking expression on her face. The unsatisfied young woman got up and wrapped a towel around herself and started towards the house. "Steve, leave everything there. Could you just pick up my bag and bring it inside? I think I need to get dressed!", in a playful tone... "No problem...", said Steve As they walked inside, he followed her around the house as it was big and he did not know where she was going. Anna's bedroom was upstairs so she went towards the tall staircase. Steve had never been that far inside her home before and was amazed at how big and luxurious it was. She ran up the stairs as she couldn't wait to go back there again. After going down the hallway being all cheerful, they turned left into her bedroom. It was huge! "Just drop the bag in the corner and let me take a quick shower... 5 minutes okay?" "Okay..." The tennis star then went inside her bathroom leaving the door open, going straight into the shower. Steve heard the water starting to run as he just started to stroll around her room. He looked at all the pictures she had on her walls, mainly her family and friends. He observed her many Junior trophies, plaques, Double championship trophies all about. After a quick look around, he sat on the edge of the bed and waited... The troubled teenager's mind was racing, thinking about what he was experiencing. He was also thinking about sneaking into Marineland at night with Anna Kournikova! That was making him a little uneasy and troubled. "Why me?", he thought... But he really wanted to stay with her and share this lovely evening... Not too long after that, he heard her shutting the water off as she had already finished washing up. A minute after that, she came out of the bathroom wearing a towel and drying her hair with another. "Told ya I wouldn't be long..." The sitting boy just looked at her as she was drying herself off... "What's the matter? Cat got your tongue? Missed me?", with a grin on her face... Walking towards the young man she kneeled/sat on him and wrapped her arms around him..."Come on... let's go have some fun... don't be so nervous!" Giving him a naughty look she said: "What? You're no longer horny?" Her towel untied itself as she sat on him as she started to kiss him passionately. She was such a good kisser... She then pushed him on his back before resuming to kiss him, sitting there, on top of him, naked... He got excited again fast! The blonde angel paused a moment, sat up and smiled as she felt him becoming hard again... Parting her wet hair to the side, the helpless boy started to caress her soft, wet and awesome body. The teasing Russian tennis star started to move around on Steve's crotch, with her naked pussy right over his again swollen member. She did a few pelvic thrusts to excite him even more. He could even feel the hotness of her vagina pressing against his dick through the fabric of his shorts. The excited young man's heart was pounding again as she continued with a gentle back and forth motion, looking at him smiling, while masturbating his erection with her pussy through his shorts. She grabbed his hands and made him caress her front side, going over her stomach area, then over her round firm breasts. "Ok, you're ready now?", asking with a spicy smile... "Oh boy... ", letting out a deep breath..."yeah ... I am...", the dazed boy replied, all worked up again... The guilty girl laughed, then got off the bed to go get dressed. The excited young man now had a big bulge in his pants again. He looked at his shirt, all wet from embracing Anna's soaked body. "Here put this on...", as she appeared wearing a pink tank top with her belly button exposed, no bra, and a small pair of pink & comfortable underwear, and threw him one of her many Tshirts. The famous young woman looked so cute he thought as she began tying her hair in a long pony tail... "Don't worry, it should fit you...", as she put on a nice little white thin jean like summer skirt. The obliging teenager took his wet shirt off and put the one she gave him on. Damn! He thought... I'm wearing Anna's clothes now! After putting on some sporty looking sandals, the hurrying girl grabbed her purse and keys and looked at Steve asking: "All set?" "Yup..." He followed her again going down the stairs, then down another all, turned in another one towards the garage area. Steve's observed all of Anna's exotic stuff on the walls and on tables everywhere, probably bought all around the world as she travelled to every corner of the globe. The young man's date for the night opened the door leading to the big garage, turned the light on to reveal a brand new silver Porsche 911 turbo S. He couldn't help but smile, looking in awe at the formidable piece of German engineered machinery. "Yeah, I like it too...", as she opened the door and got behind the wheel. Steve got in the other side as the garage door was opening. Vroooom!!! went the Porsche... turning the key inside the ignition. The young man had a big grin on his face and said: "Nice...." The woman behind the wheel looked a him with a smile as the engine purred in the echo of the garage. She gave him a wink as she put some clear & cool looking shades on. Anna pressed on the gas and let go of the clutch slowly making the car go in reverse. The vehicle now out of the garage, she came to a stop, turned on the cd player, and pressed play. Some great sounding techno was playing as the Russian driver put the car in first gear, pressed the button on the remote to close the garage door, and drove off towards the street. Stopping to look to see if there was any traffic, she opened the tinted side windows a little to get some fresh air and accelerated away... Steve was surprised how good Anna was at shifting that car... He couldn't help but look a her long athletic legs as she drove her silver street machine. Her little white skirt was going up as she was clutching away, shifting the car, giving the young man along for the ride the most provocative view of her exposed thighs... Seeing him looking down, beautiful Miss Kournikova smiled, looking at him then resumed her shifting. The curious passenger wasn't watching around, he was observing the inside of the amazing looking sports car, and most of all, Anna, just driving while her right hand's fingers were tapping on the stick shift, following the beat of the music. After a few minutes, she turned a corner and went for a stop at the gas station. They had a long drive ahead... Lowering the music..."Fill her up please.", as the gas station attendant came to her window. The tennis girl looked at her consenting hostage being all shy and quiet and said, "Wanna drive?" "Huh?" "I said, wanna drive? Do you have your driver's license?" "Hum, I have my learner's license..." "Okay...", getting out of the car to exchange positions with the quiet boy. She paid for the gas and got back in the passenger side to let him drive. Anna was trying to get him to loosen up a bit... The hesitant boy turned the key and started the car... He was being careful to do his best, concentrating on what he had to do. He put the car in gear and slowly drove off making the clutch slide, making sure he wouldn't make the car stall. "Should we take the highway?", he asked... "Yeah... Just turn right at the next light." The inexperienced driver was doing his best with the car... It wasn't easy for him but managed to get the hang of it. Arrived on the highway, he accelerated up to speed and was in awe of the four hundred and fortyfour horsepower that little car had. It handled so well! After thirty minutes, he was starting to feel more comfortable driving. "I love this car!", suddenly exclaimed the thrilled young man... "I knew you would enjoy driving it..." The blonde Russian turned the music back up again as he watched her leg starting to follow the rhythm. Noticing him checking her out again, she just smiled back at him with her pony tail flying around in the wind. The cool breeze from driving felt very good as it was still really hot and humid outside. It was going to be one of those sticky nights. She then put her hand on Steve's thigh while looking at the scenery as they drove onward towards Marineland. After a little while, the young driver was starting to get some hot flashes as he was getting aroused again from the physical contact and the view of Anna's pretty legs. Once again, she easily noticed the small bulge in his pants beginning to grow. Seeing that, she naughtily started to rub his thigh a little more vigorously trying to excite him more... It worked really well! He was getting a major hard on as the mischievous tennis girl was clearly trying to arouse his senses. The naughty Anna was toying with him big time! She then slowly went up his leg and started to caress his inflated penis through the fabric of his shorts. The young man was caught by surprise and couldn't do much as he had to keep on driving! She then ran her nails on his uncovered thigh, then sat on her side... Taking her right hand, the teasing girl began to gently run her nails over the helpless driver's stomach under his shirt making him shiver all over... Going down with her exploring hand, she took his swollen member, and tightened her grip around it, squeezing his major erection...There went Steve's little heart again...He opened his mouth to get more air as his state of excitement demanded more oxygen from the rush of hormones running through his veins. "Just keep your eyes on the road now will you?...", said Anna with a soft placid tone. The little prick teaser untied his belt, undid the top button, then slowly pulled on the zipper of his bermuda shorts. She resumed caressing his stomach and went down towards his underwear which was covering his blood filled sexual organ. She leaned over and started to passionately kiss the powerless boy's neck, then his ear, brushing her tongue and passionately breathing into it. Anna then ran her hand inside his underwear and began to fondle his penis, then lower, gently caressing his balls and back to his shaft. Steve was in heaven, the whole experience felt like a dream...Anna pulled his dick out, and just watched it. She was finally seeing that strong erection that had been manifesting itself for her. Pleased with what she was seeing, and after admiring and gently caressing his penis with the tip of her fingers to make it twitch around and make sure it would be rock hard, the teasing girl then seized his shaft, and very slowly began to masturbate him. Steve was breathing really heavy now, as he looked at the famous tennis player's strong hand stroking his engorged penis; this felt awesome! He took his right hand and grabbed Anna's proportioned left thigh, feeling her satinlike skin again. She took her cool looking shades off, got into a better position and bent down over his genital area. "Oh my god!", thought Steve... "Is she going to do what I am thinking?!" To his ultimate delight, his beautiful passenger pulled his underwear down a little more and started to kiss his calling penis, squeezed it hard keeping her up and down strokes with her right hand, forcing all of the precum out its tip. She stuck her tongue out and licked the all the precum off its head, and swallowed it like she was suffering from sperm dehydration. She opened her mouth and took his member in her oral cavity, and started to give him the most exquisite aweinspiring session of oral sex. The inside of her mouth felt so hot and moist as all the juices swirled around his gracefully suckled love tool. Feeling her hair tickle his general genital area while he watched her blonde head slowly starting to go up and down on his member, the enraptured teenager tried to realize he was on the highway, with the famous tennis star giving him a blow job while driving her Porsche! With Steve's right hand now on her shoulder, she continued to graciously suck his member to the beat of the music. He could even feel her tongue going up his shaft and around the head of his penis every now and then. He never imagined all of this could happen and the night was still young! He watched the people in their cars passing him by, to see if they were noticing anything. He could feel Anna's mouth tightening up around his dick, slowly going up and down, while she clearly enjoyed the feeling of his inflated penis inside her mouth. The people passing by were all ignorant of what was happening inside the vehicle. Steve raised his head and closed his eyes for a second as he felt the sucking of her mouth increase around his rod. He was losing control of his body reactions, the grip was tightening on the steering wheel and his right hand seized her long hair. Anna responded to the grabbing of her blonde crown only by greatly intensifying her oral massage. She was almost nursing his spear of love, nearly begging for an ejaculation, moaning from desire, being consumed by lust, thinking "she" was the cause for the blood to be trapped in his member. It was "her" erection, and the sperm that was being produced in his balls was meant only for her. Her pace was getting faster and so was the Porsche! Steve was unknowingly pressing the gas pedal, pushing his legs down from the intense pleasure! He just looked in front of him as the scenery was going by like he was flying in an wet dream, passing cars and road signs faster and faster. As the car remained in sixth gear, the acceleration was gradually building up like the stream of his sexual fluids wanting to explode down her wanting throat, while the sound of the music covered up the sound of ferocious car engine. Sensing the excitement, and the car starting to go a little fast she then stopped, but slowly continued to jerk him off, looked at him and said in a sensual voice: "You like that Steve?...", with half closed eyes... "Ooooh yeah......", he replied a little out of breath, looking at her pretty face while the scenery was still going by fast behind her like it was a movie in slow motion... "You can slow down now...", grinning... She started to look around to see where they were at... "Oh! Sorry!", as he looked the speedometer indicating 125mph! "We must be close...", she replied, not bothered by the speeding incident... "I think you're right. I think it's the next exit...Wow, that little trip went by fast...hum..." "Time always seems shorter when you're enjoying yourself." Anna pulled the visor down to look at herself in the mirror, wiped the corners of her mouth with her fingers, looked at him and said: "Oh geez, I can't wait to get there...Will there be anyone there though?" "Nah... just a security guard at the gate, probably asleep or watching TV.", as Steve struggled to put his still half erect penis back in his pants... Steve's balls were starting to hurt from all the sexual arousal without having an orgasm. "Sorry about speeding back there again..." "Don't worry about it...", said Anna smiling, as she knew how he must of been feeling..."I'm not done with you yet...Do I look okay?", she asked. "I'm not going to answer that stupid question", he replied with a mocking smile... "Ha ha..", she quickly laughed out... He then saw the exit they were supposed to take, slowed down and downshifted the expensive street machine to city speeds taking the exit ramp off the freeway. After going around a few streets, five minutes later, they arrived at their destination. The anxious tennis star got a cap off from the back seat of the car, and put it on, trying to hide her identity. They then got out of the car to walk towards the employee entrance. "Don't worry...", he implied..."Just let me do the talking, we shouldn't have any problems going inside..." "Yes sir!", in a playful tone..."I thought this was supposed to be hard!", teasing... Arriving at the gate, the old security guard looked at them and said: "Hello to you there Stevie boy, you brought a friend tonight? Might I say you got some nice wheels there my son..." "Hum yeah, she's coming to give me a hand to see if she would like doing what I am doing here lately... And... huh, it's my uncle's car." "Well your uncle is very kind and thrust worthy in lending you that fine automobile... And might I say, your little girlfriend sure looks pretty there son... And your fly is down." "Oops! I should go get started... I have a lot of work to do tonight...", zipping up his pants, with the guilty tennis girl hiding behind him trying not to laugh out... "Okay, go right on in..." Steve led the way inside, as she closely followed him... "Stevie boy?" asked Anna... "Don't start! He's kinda annoying sometimes..." "He looks like a nice old man, don't be so hard on him..." "Yeah I know... He's just weird sometimes..." "Everybody's weird Steve..." They arrived at the employee building... Steve took his keys out, unlocked the door and went inside. He flicked a few breakers to turn on some lights and took a writing pad off the wall... "Watcha doing Stevie boy?", still making fun of him. "Just looking at the feeding and employee schedules. Looks like nobody will be here till early morning and everything as been done..." "That's perfect!!!" He took a whistle and some keys off the wall, then put the pad back where it belongs ... "Follow me and close the door on your way out please", as he led the way towards the animal enclosures. The improvised tour guide began giving her a quick go around, showing her where all the animals slept... The sea lions area, the orca pool, and finally the main pool...The reflection of the moon could be seen on the surface of the water as it was such a nice hot and clear night. There wasn't a single cloud in the sky. "So this is what you wanted to see so bad...", said Steve... He went to another breaker box, flicked a switch turning the lights on inside the pool. The water was so clear... It was sure a beautiful sight. There wasn't a single drop of wind, there were no ripples or waves covering the surface of the water. Only some where the filter outings were placed. It was so quiet, the only thing you could hear is the buzzing sound of the lights around the pool and the water jets. It was so relaxing... "Where are the dolphins? This pool is empty!", Anna asked... Like every spoiled celebrity, waiting was not her strong point. He went over the other side of the pool with the set of keys he took from the employee's office, went over a gate that was on the opposite side, unlocked a padlock, and opened the gate. She then heard bursts of air and water; it was the dolphins breathing out. Hearing a series of clicking sounds, some dolphins were swimming out of the holding tank into the show pool. "Oh! There they are! Steve! I can see dolphins!", she exclaimed with a childish excitement... The young teenager smiled as he watched the world known tennis star all happy, looking at the sea mammals starting to swim about. He walked back around the pool to her side to share the moment with her. Anna grabbed his arm and said: "Steve, thank you so much for bringing me here tonight!" "Watch this...", as the aspiring dolphin trainer then blew into the whistle he brought with him. All the dolphins started to swim around faster and came towards them at the side of the pool in the shallow area. "Stay right here...", he ordered ... "Oh... they are so cute!!!" The delighted tennis girl saw all the agitated dolphins coming right near her as they clicked and playfully sprayed water with their blowholes, swimming vigorously, yet so effortlessly. One of them came real close with its head out of the water and began observing the blonde visitor, probably wondering who she was. She looked at the mammal and saw it looking at her straight in the eyes. Everybody knows, encountering dolphins is something very unique. When it looked at her, she felt it trying to "check her out". Like: who is that? What is she doing here? What kind of person is that human standing there? Clearly happy and smiling at me... That doesn't look like a tourist... She could clearly feel just by exchanging visual contact how intelligent the mammal was. This one looked very curious, kind and also very young. Anna took her shoes off and kneeled on the edge of the water and kept looking at all the dolphins just floating there waiting for something, with their famous permanent smile drawn upon their faces. Not a second later, Steve came back with a big bucket of fish. That's what they were waiting for! Food time! "Come over here on the platform Anna..." They went over to the trainers platform, which was about six by eight feet. This trainers platform was almost water level as some water could come over it if there were to be any waves. It was padded up with a thick cushiony rubber material to prevent slipping and falling and also from getting hurt. With both their shoes off, he started to feed the dolphins. They all came really close and opened their mouths to beg for a food treat. He threw the little fish at the sea mammals as they caught the food in mid air with amazing agility. "Ha ha ha... they're good catchers!", exclaimed Anna. "Watch this...I know a few tricks..." He blew into his whistle and all the dolphins swam a little back. One of them went really far as Steve was giving the animals some signals with his whistle. Making a move that he was about to throw a fish strongly, the dolphin swam towards the center of the pool really fast and came straight out of the surface jumping way high above water, leaping for the food treat he had just thrown with surprising timing. The dolphin caught his catch and splashed back inside the clear water of the pool. "Ha ha ha!", Anna was loving this..."Now this guy is good!!!" The young teenager smiled at the Russian tennis star filled with joy, standing there with him on this night. He was having the time of his life...He blew into his dolphin calling instrument again and only a few came back towards the platform this time. One came real close, he was trying to make it do something. It turned around in a small circle then propelled itself out of the water on to the training platform with perfect force. "Oh Steve!", with the dolphin now out of the water, on the platform right beside her..."Can I pet him?" "Sure... just be gentle and friendly..." "Hi little dolphin!", kneeling onto the platform next to it, looking at it, and carefully approaching it. She started to caress the animal on the side of its head. "He's so nice!" Its skin felt kind of leathery, really smooth to the touch...The animal's polished skin was the result of thousands of years of evolution. Its skin suit smoothened and its body designed to glide through water like a fighter jet through the earth's atmosphere. It also felt very muscular and strong, she could feel the strength of the powerful animal as she pressed her hand against its streamlined body. Steve gave the dolphin a fish then it pushed itself back into the water splashing water all over them. "Oh you naughty boy!", she said laughing... "Getting close to dolphins will surely make you get wet. I think he likes you, I can tell... That water splash was a sign of acceptance. These things can really know how you are feeling towards them." "Really?...", asked the intrigued girl... "You wanna go swim with them? I can go get us some wet suits in the cabin and..." The impatient dolphin lover got up as he talked and removed the white skirt she had on, threw it away form the water's edge, undid her pony tail letting her beautiful blonde hair down, and jumped in the shallow area where the water was about waist level... "Come on! Don't be a sissy! The water's good... jump in!" The tip of her hair caressing the top of the water, she looked at him standing there on the platform... The eager young man removed his shirt and shorts, keeping is boxers, then dove in the water..."Oh wow... the water is so warm... The hot weather we're having lately really warmed up the pools. The water can be quite chilly sometimes..." The water was about eighty degrees Fahrenheit, or twentyseven Celsius... The friendly pair started to swim around having fun, splashing each other as the dolphins watched them. As they were playing around, one of the sea mammals came close to them and checked out the intriguing blonde visitor again. She was pleased to get such quick attention once inside the pool. "Hi little dolphin...", said the friendly Anna in a gentle tone. The friendly mammal then started to get real close, swimming around the curious girl brushing himself against her soft human skin ever so gently, accurately using its pectoral fins like the brush of a painter on a canvas. The caressing of the waterborn animal was surprisingly pleasant, coming into contact with its long smooth body like a breeze against the top of a leafy tree line. "I think you got some fans there...", giggled the observing young man... "He wants to play with you..." "What should I do ?" "Grab him firmly by his dorsal fin", he explained... Right after being grabbed, the big sea mammal began swimming, dragging its thrilled passenger around the pool. Having a great time, she had to let go of the dolphin before swallowing too much water as she was laughing too hard to adequately keep holding on. "This is so much fun!", as she swam back towards the shallow area... Standing on her feet again in the shallow part of the pool, the attentive Russian noticed one of the dolphins coming back towards them dragging and pushing a big orange ball above the water. "Ha ha ha! Where did they get that?", she asked... "They must of brought it from the holding tank. We always leave them some stuff to play around with over there." The acrobat mammal skillfully took its snout a taped on the ball hitting it towards its playing partner. The ball fell a little short as she walked to go get it. "Throw it back to him!", shouted Steve... She threw the ball at the dolphin and to her surprise, it caught the ball with its snout hitting it back at her. All smiles and laughing... "Ha ha ha! Can they play tennis too?" She kept throwing the ball at her new found friend a few more times when on the last throw, the ball went far outside of the pool. "Ooops! I'll get it", said the laughing girl... She climbed the ladder and got out of the pool to go get the ball. Looking at his all wet dream girl, he watched her fantastic gleaming figure as she scaled the steps, exposing her gorgeous butt in the process. "Damn her round behind looks fine!", thought Steve as he stared at her wet and exposed rear end dance again while she was walking away. She got the ball and threw it hard towards the deeper part of the pool. The seductive water covered woman walked back, with her soaked little pink tank top glued to her titillating front side, the fine pink cotton underwear hugging to her feminine parts between her legs. The material was very thin, once wet, he could clearly see the shape of her sex through the soaked material. The dazzled young man stared at her in awe, she looked so beautiful, so sexy... He felt like cupping her round breasts, reaching for her nipples that were poking out, and tearing her fragile underwear off. What a sight! The tennis star saw him checking her out and looked at him with a smirk on her face... "What are you looking at Stevie boy...?" "You...", replied the infatuated teenager... The walking wet angel walked to the edge and sat down with her feet in the water. The young man went towards her as she was holding her index in front, making a calling gesture. Taking his hand as he got close, the charming Russian pulled him next to her between her legs, grabbed his face with her hands, closed her big meadow green eyes and began kissing him. Their labial orifices connected in the most gentle way, her mouth was so soft, her lips were just perfect, she was such a great kisser. Starting to use her soft tongue as they began french kissing, exchanging fluids from their passionate embrace, the teenager began caressing the Russian's soft & proportioned wet thighs, stroking them up and down as they kept on smooching. Steve wasn't too bad of a kisser himself, as his kissing partner paused and smiled at him. She then jumped in the water and took him into her arms as the water rippled in a harmonious sequence around their waist. It was so quiet again, Anna then pulled off her drenched tank top exposing her bare round breasts, and threw it in the pool. Pressing her naked torso against him, they resumed their impassioned lip lock. The hypnotized boy could of kept on kissing his dream girl like that forever...He caressed her naked back as he hugged her in his arms while their mouths fondled each other. They then heard something... One of the dolphins came around next to them and was carrying Anna's top in its snout. It kept playfully swimming around near them with her tank top, then let it go to catch it skillfully with one of its flippers, then with its tail, after did a U turn to grab it again with its snout. The dolphin was clearly playing around, demonstrating his extraordinary agility. They both laughed as they watched the goofy sea mammal fooling around and resumed kissing. Steve was becoming a little more aggressive and gradually pushed her back towards to side of the pool. As her back touched the wall, she paused, removed her underwear, and threw them in the pool adorning the naughtiest of smiles. They went back to necking again as his now erecting member pressed against the delicate hardness of her abdomen. She could feel his beating excitement pushing against her as he wanted her so bad. She took one of her hands, seized his erected organ and began to slowly masturbate it through his wet underwear. By the way she was clamping and fondling his rod, he could tell how much she was sexstarved for his erection. The obvious sexual intent of his raised penis was making her female organs fill with lubricating fluids again. Both were now, sexually aroused... Steve started to grab her ass cheeks firmly with his hands as they continued their foreplay. The willing girl then pulled his underwear off with their bodies tightly pressed together. She felt his completely erect member pressing against her belly now, thumping like it was knocking at her door. Pulling back to look at it, she took it in her hands as precum stretched away from her abdomen as his penis's head was right above water. Squeezing his shaft, she slowly starting to jerk him off again... The aroused boy was breathing hard from excitement, losing control from her godlike hand job...Looking at him in the eyes, she observed him becoming entirely lost in sexual pleasure. Anna kept going up and down his shaft then took her other hand and gently fondled his balls as he closed his eyes, completely lost in ecstasy! After a few minutes which seemed like hours, she stopped, raised one of her legs and wrapped it around her mate. Steve knew what she was doing. He lowered himself in the water, took his penis and rubbed it against her swollen vulva. The horny tennis star wanted him to make love to her in the pool. It didn't take too long and he began penetrating her Russian made sex organ with the head of his penis, gradually going deeper on each slow thrust. His member was gliding inside her like it was meant to be there. Her vagina felt perfectly tight around his penis like it was air sealing itself. He slowly began to fuck the willing tennis star in the pool with her right leg still around him. Boy did it feel great! He dug deeper and deeper into her pussy, feeling the lips of her love hole stretching around his tool. The sexed up Russian tennis girl started to moan from the back and forth motion; she was really enjoying this... Wrapping both of her legs around his waist, she made him go all the way in, letting out a soft moan. "Ooohh...", as their pubic hair regions touched. The young man grabbed her by her butt, his member still all the way in, tried to do his best, but this position was really hard to do in the pool. Climbing off her sex slave, Anna turned her back to him, held the side of the pool with her body bent forwards with her ass just breaking the surface. The hasty young man came in from behind and observed the famous tennis star's gleaming arched back while she was waiting for him to take her. Her back was carrying a small puddle of water in the middle of her spine area, just below her tattoo where her dorsal muscles were trapping it. Coming in closer towards the waiting tennis girl holding on to the edge of the pool, he caressed her lovely back, splendid buttocks, rubbed his hand over her genitals, guided his dick into her pussy and entered her from behind as she breathed and moaned from pleasure. She began moaning on each thrust as his member dug deep inside her vagina. "Ah!...Ah!...Ah!...", holding on to her waist, and began fucking the submissive tennis star from behind inside the show pool. The pounding young man kept thrusting away, as he observed his dick penetrating all the way in just beneath the surface of the clear blue water. The inside of her vagina felt so good, and the willingly assaulted Anna was enjoying it so much that she was bucking her hips backwards to have her love slave penetrate her stronger. Their bodies were now slapping against each other a little more violently as the water began splashing from the sexual pounding... The noise had attracted the attention of the friendly sea mammals swimming around. One curiously got closer and observed them mating inside their watery environment. The dolphins are very intelligent and this one knew what they were doing as it began to have an erection. It swam over towards them, came in between both of their legs, brushing against them in the process, upside down with its dick hanging out. It did a few humping motions below the water then swam away. "Did you just see what I saw???", asked Steve all surprised by the incident. "Sure did, aren't they allowed to be horny too? They must know what we're doing...", she casually answered. "Well that was kinda strange! No?" "Not really...", replying with a sexy face... The stumped young man did not answer back and remembered the dolphin dildo he used on her earlier. The undisturbed Anna then began to tap the water to call it back. "What are you doing?", asking with a worried tone... "Relax, I just want to calm him down..." The confused boy watched her standing there naked as she kept trying to call the dolphin... "Here boy, come! There's no danger, we were just making love..." The intelligent sea creature felt her tone and swam to her very slowly with total confidence and came right beside her. "Hi there little buddy, it's ok... there... oh you're such a little sweetie.", as she caressed it, giving it a kiss on the side of its head. The dolphin began to emit some clicks probably wanting to say something. They both laughed and Steve said, "Wow, you're really good with these guys..." She smiled at him, as the dolphin's head went under water. The mammal then took its snouts and pressed it against her genitals and quickly did something to her. The animal gave out a quick burst of sonar clicks which released very powerful vibrations right on the tennis player's vulva as little bubbles of air came out of its snout going up her crotch with a tingling feeling. The feeling was so intense that the shocked girl's knees buckled from the dolphin's doing; almost giving her an orgasmic sensation... "Oh my god!", she exclaimed. "Are you all right?", quickly asked the worried boy... "You bet I am! Oh geez that felt awesome! He just did the strangest thing to me! His snout vibrated like, really strongly, and... and I almost came on the spot!" "Are you serious?" "Oh yes I am! ...Oh my god that felt good!...", as she was still trying to recover from the incident. She remembered the vibrating mode on her dildo at home and would never use it the same way again. The naughty dolphin swam back slowly towards her and just stayed there next to her. She pet him on the head and said: "You naughty little fishy!... Do you know what you just did to me?" The guilty marine mammal started to emit some loud clicks with its head above water, looking at the blonde figure standing there. They both started laughing again thinking that it was trying to communicate... "Now that was funny...", as she petted the dolphin. She looked at Steve smiling as he stood there watching her. Planning her next move, Anna subtly began giving the mammal longer strokes along its leathery body, still staring at the attentive young man. The exploring tennis girl kept on stroking the animal and went down lower along its body. Her hand gradually going on its side as she caressed it along its length, approaching its genital area bit by bit. "Anna ?...", asked the perplexed young man... Anna didn't say a word... She just kept on stroking the mammal with long and delicate strokes. She used her hand as well as her forearm to have more contact with its smooth body. The skin of a dolphin is very sensitive, its outer layer is entirely made of live cells. The animal twisted around, arched its body, obviously enjoying the human girl's delicate touch. The stunned boy kept watching her, stupefied at what was happening, as the dolphin then went on its side presenting its underbelly. After gently caressing its underside, she continued on to the slit area of the sea mammal. Within a few seconds, its large pink dick began poking out again as the dolphin was getting an erection from Anna's careful manipulation. She kept caressing around its erecting penis while looking at Steve to watch his reaction but he still didn't budge, still staring at her, speechless. Her eyes then turned towards the protruding sex organ of the sea mammal and intensified her rubbing around it. She clearly enjoyed the sight of the dolphin's large erected penis while she kept exciting the friendly dolphin. The paralyzed boy tried to gather his thoughts and said to himself: "She's not going to try to do what I think she is?!" He couldn't help but watch without saying a word, fearful of the night of passion coming to an end... She then gently began caressing the animal's large penis then took it in her hand and began to squeeze it. The marine mammal's member felt very big, hard and rubbery to the touch. A dolphin's penis is not vascular like a human's, it's mostly all muscle down there. The horny tennis star could feel the pronounced ridge along the length of its large organ as she slowly began masturbating the animal. It then turned, took a breath from its blowhole, and went belly up exposing its big pink swollen member above the water surface. Its sexual organ is also somewhat prehensile(It can wiggle around but not quite grab objects). The astonished young man couldn't believe what she was doing but kept looking at what was happening. His heart was racing, he looked down and noticed his dick was rock hard! To his ultimate surprise, he was enjoying watching Anna do this! She took the big penis in her hand again, bent down, and started to kiss the underside of the animal, going towards its erect member that was twitching around in excitement. The skin of the dolphin felt so smooth ... Much to her satisfaction, it didn't have much of a body odor at all because a dolphin doesn't have any skin glands whatsoever. She then kissed the tip of its penis and began to rub the large erecting member over her face. The penis craved girl was breathing a little faster now, clearly enjoying this. Starting to lick its tool while still looking at the worried young man, the tennis star opened her mouth and began sucking its dick. It felt very big and rock hard as she spread her lips over it, and to her enjoyment, almost tasteless as she stroke it with her tongue inside her mouth. Licking the animal's member along its entire length, from base to tip, it began coiling its penis around her tongue inside in her mouth in some kind of exotic genital embrace. The impassioned tennis girl lustfully commenced some kind of French kissing with its long and spiraling sex appendage. Sensing the arousal of the turned on mammal, the hungry blonde began taking its long member deeper inside her wanting mouth. She felt the animal's long pointy penis quickly finding the back of her throat as she took in as much as possible. Steve almost pinched himself trying to wake up from a weird dream. He never knew the perverted Russian tennis star had those fantasies and that she could be so kinky! The dolphin dildo was starting to make even more sense now... Anna's head began going up and down on the marine mammal's sexual organ, gradually trying to deep throat the animal. Her lower jaw was now fully extended open to accommodate the large base of the penis inside her oral cavity, as the smaller tip of the animal's love tool began invading the starved girl's throat passage. The dolphin's erection reached its max, and it was a big one. It was at least nine inches and she was trying to take it all in. After about a minute of passionately sucking the dolphin's huge pinkish rod, she stopped, took a deep breath, and resumed masturbating the animal with long and fast strokes with her right hand. She kept looking at Steve, fearful of his reaction, but loved the way he was watching her. She then noticed his tall erection poking at the surface of water and now knew he was turned on by this, so she pressed on with her impeccable hand job a little more vigorously, wanting to make the mammal climax. After thirty seconds of manual stimulation, the dolphin started to shake and jerk and did some humping motions as it was about to come. Breathing heavier with her mouth open, anticipating the animal's orgasm, the ecstatic tennis girl looked at its engorged penis as it violently began spraying its sperm. The big sea mammal came in Anna's hands, shooting its semen forward with tremendous force, exploding all over her. Some was landing on her hands, forearms, stomach and even on her pretty face. She slowed her pace squeezing the remaining seminal fluids of the contented animal, oozing over her hand while it kept shaking from orgasmic sensations. Giving it a final passionate suck, dragging her lips tenderly over the seeping animal's member, the Russian girl made its penis do a few more contractions of pleasure, pumping its remaining jism inside the wanting girl's mouth. Losing its erection, it flipped over, took a breath and slowly swam away. She looked at the aroused boy watching her with a sexual look on her face, took her hands and rubbed the animal's bodily fluids that had landed on her tummy, making her golden skin absorb the dolphin's juice. She then took her middle finger, scooped the sperm that had landed on her face, stuck out her pretty tongue, and licked the marine mammal's semen off her digit, gulping it down. The aroused young man watched her throat as she swallowed it...He was totally turned on! Anna then walked over to him without saying a word, looked at him with her arched eyebrows like a predator watching his prey, grabbed his dick with both of her hands, squeezed it tightly, and began to masturbate him staring at her hand job victim straight into his eyes with her predatory gaze. Up and down her strong hands went on his aroused swollen member making the young man's head tilt back in pleasure. The blonde girl's hands on his penis felt better then anything he experienced before; she just had the perfect grip. The victim of manual stimulation was way overdue to blow his load and could feel it building inside him. He started breathing heavier as she kept fucking his tool with her hands. "Are you going to come for your little Anna? Hmm Steve? I know you wanna come, come on, give it to me..." She grabbed it even tighter and tighter... Started to go faster and faster... After a couple of minutes she felt his orgasm was soon coming. "Oh yeah, come for me Steve, come for your little Anna...", the frowning girl said with a raging wild look on her face, clenching her teeth together as she jerked him off to paradise. With perfect timing, before he would reach orgasm, she stopped, bent down and put her head at water level, grabbed the teenager by his ass, and began deep throating him. His dick was going all the way inside her mouth. "Oh Annaaaa....", exclaimed Steve as he was about to come from the overwhelming sensation of the hot and moist insides of her oral cavity. He could feel all the inside of her mouth hugging around his penis as she was sucking him good. He could feel his member going down her throat as his knees started to shake. Anna went faster and faster until the young man couldn't hold it any longer. "Huuuh!", he exclaimed as his first orgasm contraction hit his body violently. He started to come inside her throat as she didn't let go of his member. She grabbed his balls and curved them up to feel his genitals contract as he was shooting bursts after bursts of hot sperm into her mouth. "Mmph...Mmph...Mmph...", as she swallowed it all on every shot, vocally expressing satisfaction, as her man was having the most powerful orgasm of his life. He had been teased with for so long so there was a lot coming out, but she didn't waste a drop. The sperm hungry girl took her mouth off of his penis and took a deep breath of air. She slowly kept masturbating him as he finished coming. As he looked down, he watched the blonde culprit squeezing the remaining jism out of his dick and licking it off, sticking out her tongue, then gulping it down as she looked at him with her piercing bluegreen eyes. She had such a sexual look on her face! After making her young man come, she stood up, still holding and jerking his dick slowly and whispered in his ear:"Steve...", she said with a soft voice..."I want you to help me, and watch me get fucked by the dolphins..." He didn't know what to say, but after having an orgasm like he just had, the satisfied teenager was willing to do anything now... A few dolphins were still swimming nearby, watching the show... "What? Are you sure about this?", he wondered... "Yes I am ....", in a most certain tone... "What do you want me to do?" "We'll figure it out...", as she walked over to the ladder..."Here should be good..." The longing Russian tennis star began trying to call the dolphins over, tapping on the water again, hoping to copulate with them.. It didn't take too long and some came really close by. They had developed a trust with her, and they could fell that the visitor with long hair had only good intentions. She picked the closest one and started to socialize with it, gently talking to it and caressing it; trying to rub it the same way she did with the first one to get it aroused. After about minute, the insatiable girl easily managed to make it get a hard on, and a big one too! She then put her body in a fortyfive degree angle, with her front side up while holding the ladder bars, her arms over her head. The dolphin just swam around not sure what to do. It couldn't figure out yet what she had in mind. There was Steve, trying to hold her body a bit higher in the water now to present Anna's crotch to the dolphin. Finally one came near but did not try to mount her. Instead, it shoved its snout into the awaiting girl's pussy and did the same thing as the other one did before. It was so powerful! Like ten times the feeling of a normal vibrator. The young woman shook as she cried out in pleasure... "Ooooh! oh! oh! ooooooh!" The teenager felt her body shake from the intense sensations she was having as he held her body in his arms, watching the dolphin with its snout between her legs. The whole thing didn't last longer then five or six seconds but what a rush! "Oh my... this is so intense...", exclaimed Anna as she stood up again in the pool. She turned around and reached for a towel to wipe her face giving a great back angle. As she did that, it came around started to nibble at her privates from behind. She grabbed the ladder and looked at Steve and said: "Try holding my legs up and apart..." He grabbed her by the ankles and stretched her body near the surface of the water. The dolphin stayed there and as the girl's body got stretched out, then dug its snout into her crotch again starting to use his sonar trick. This time, it was pressing directly on her clitoris as well. Steve could have a clear view at the mammal's snout on her pussy and saw the surface of the water ripple from the sudden fierce vibration. It kept doing it longer this time and did it three times in a row. "Ooooh!...Ooooh!...Ooooh!..." Anna came right there on the spot as she was overtaken by the sea mammal's doing. Watching the tennis star contract herself as she came violently, he witnessed her perfect little pussy starting to ejaculate a big amount of love juice in the water over the dolphin's snout. He then let go of her as her feet hit bottom again. Tasting the human girl's love juice in the water, the mammal quickly flipped around exposing his hard on and swam between her long two legs and started to hump at her crotch area. "Ah!!!", she exclaimed loudly as she felt the dolphin's member coming in contact with her sensitive vulva. The horny sea mammal stopped as its head was too close to the wall of the pool, swam away and did a circle. It now was wanting to fuck the beautiful human girl that was toying with them, penetrate her and mate with her. Even though her legs where still all wobbly from just having an orgasm, Anna got back into her initial position, holding the ladder with her front side up, as she saw the big mammal coming around. She tapped the water above her stomach area to guide the dolphin over her. Finally, the invited marine friend grazed the top of the blonde Russian's front side as it swam over her. She pulled her legs apart and raised her hips up just a little to give a nice angle and some room for the big dolphin. After about ten seconds of getting in position, lowering its tail in the water between her legs, the blonde tennis star kissed the animal on the side of its face as the animal's huge pink penis probed at her genitals. After poking around, it found its mark, and penetrated the tennis star's awaiting vagina. She had been waiting for this for a long time ... "Aaaahh!...", she exclaimed as its large penis went inside her. The dick was really big and painfully stiff and rigid as the dolphin introduced his pink tool inside her a little quickly so it hurt, but felt very good after a few seconds. The big sea mammal was directly above her now, its smooth body brushing against her soft and tanned skin. The contact of their flesh was exquisite and very special. She lifted and pressed her body as best she could against it to enhance the pleasing sensation of the joining bodies as she gave herself up to the willing dolphin. The helping boy looked as her pretty round breasts were being squeezed from the pressure. He observed her abdomen and inner thigh area brushing against the big sea mammal's working tail and body. It then gave a few thrusts to dig a little deeper and get more comfortable inside the human girl's vagina. After about another twenty seconds, with the help of its broad tail fin to propel itself inside her, the dolphin started to hump her at a rhythmical pace... "Ah, ah, ah, ah, ah, ah ,ah!", the marine mammal's mate began moaning wildly! She let go of one arm and held on to the dolphin as it kept fucking her, caressing its leathery skin with her hand. The sea mammal's penis was huge and getting bigger, especially at its base. It was stretching out her vagina wider and wider, as it went in further inside her on each thrust. Its erected penis felt so hard inside her, this one was bigger then the first one and dug in very deeply. But it wasn't even all the way in yet... She started to breathe hard on each thrust as she was losing her mind. The submissive girl then laid back, turned her head a little to the side and closed her eyes as the big animal was humping away at her little pussy while Steve observed its forceful tail thrusting between her legs like it was a big waterborn fucking machine. Its tail fin was propelling the mammal forward, hitting her pubic area a little more and more violently as it wildly fucked the Russian tennis star. The impact of her pubic bone was stimulating her Gspot and she adored it... "Ah! Ah! Ah! Ah! AAAH!", as she was getting hit by the penetrating dolphin...she was about to come again! The bestial girl then wrapped both her legs around it as it pressed on. With that position, the dolphin's dick could go even deeper inside her, but she had no way of holding her body up without her feet hitting bottom; her head was starting to go underwater. Steve quickly went over and tried to lift up her body in a position that she could breathe again while the relentless dolphin kept going. She opened her eyes again and looked down to watch this big beast boring inside her, as it was rubbing its S shaped penis right against the underside of her Gspot. Combined with the ramming of her pubic bone, the sensations were overpowering as her body quivered, tightening her lovely toned thighs around the animal, yearning for pleasure. The big sea mammal's ten inch penis was going all the way in now on each thrust. The young man held the half drowning woman in his arms as best he could, as he felt his arms weakening on each thrust from the mighty lunges of the animal, completely filling up her vagina. She was swallowing some water and trying to catch her breath, completely out of control as the dolphin kept on humping and humping. Anna then realized she was being wildly fucked by a beautiful and horny marine mammal and loving it! "Aaaaah! Aaaaah! Aaaaaaaaah!" She started to come in a violent way as the dolphin's penis got real hard cause it was about to come as well while the struggling boy did his best to keep her head above water. She could feel every detail of the animal's sexual organ inside her as it was swollen up to maximum, while her stretched vagina walls tried to contract around the animal's big penis as she was beginning to come. The dominated girl was so filled up, there was no room for her to tighten up her pussy as she was coming. The sensation was overwhelming! "Aaaaaaaaaaah! Aahhhhhhh!", as her orgasm kept on going, feeling the hammering dolphin starting to come inside her. Thrust after thrust, Anna could feel the sperm shooting really hard inside her as it pounded her real hard while she was clearly in ecstasy. The animal jerked, filling her with every bit of semen he had, shuddering as it was coming, thrusting and arching its tail to come inside its human partner as deeply as it could. She could feel the large quantity of semen invading her insides on each orgasm contraction it was having while her own climax was making her constrict around its pumping tool. The dolphin was pounding thrusts after thrust of love juice about every second for nearly ten seconds as Anna's body shook each time from pleasure. She felt the dolphin contract all of its muscles from the sexual climax it was having while she tightly held it in her arms. After a few more deep and powerful thrusts inside her, as both came violently together, her and the dolphin both relaxed and caught their breaths. With its massive organ still inside her, the abused blonde kept holding on to the dolphin for a minute before she felt the animal's dick shrinking away. The dolphin just laid there, on top of Anna, resting its head on her shoulder, looking at her. She could feel the big loud thumps of its big heart beating as they hugged. She never thought she could have this kind of profound connection with an animal. She held it in her arms, caressed it and gave it a nice kiss on the side of its head then resumed her hug. After about five minutes of total quiet, it slowly swam away. Anna just said one thing... "Wow..." Steve really was amazed at how much he enjoyed all of this. No wonder they have a huge permanent smile on their faces, he thought. The only problem, Anna was getting submerged by the animal in that position. So he got out of the pool and went to find some kind of floating board. "I'll be right back...", he said. "Okay..." As the searching teenager was looking for his board, there was something going on in the pool. Another one came back swimming near her and it had a huge hard on too! Anna was looking away, waiting for him to come back. The waiting girl was letting herself float in the water while still holding the ladder, but her ass was facing up. She then felt a dolphin's snout vibrate between her legs again. Her pussy had become very sensitive, so she had the reflex to go lower to get out of the way from the sudden overwhelming sensation. As she did that, the surprised tennis girl turned her head around and saw her perpetrator as it swam over her back getting in position for sexual intercourse! It was a lot more aggressive and very horny. It wanted to have a go at Anna too. The the tip of its penis wiggled, poking at her crotch with amazing gracefulness. This one was the oldest and biggest; it was at least seven to eight feet in length! Anna was surprised and a little intimidated by him but didn't move as she decided to let him have a go at it. The Russian pervert was in sex mode and wasn't finished yet, she wanted more and simply decided to let herself be dominated by this large horny dolphin. She could feel its member probing at her pussy area, fondling the erogenous zone between her legs with its tool as its long slick underbelly grazed over her entire back. After about ten seconds, the big dolphin found its mark and began entering the blonde girl's vagina. Its penis was a lot bigger. She could feel the sheer size of it expanding her walls as it was gradually digging deeper inside her. His enormous pink probe was near twelve inches with its large base almost as wide as the middle of her roundish forearms! "Oh my god you're a big boy aren't you? Ow...huuuuh...What am I doing! This ain't right! Oh... Ow... AAAH!" Just as she said that, the dolphin began hammering away and it was hurting a lot! It wasn't taking its time, it really wanted her badly. Anna could feel her pussy totally stretched out by the animal's member as her body moved back and forth in the water from the pounding of the big dolphin she was receiving. She held on tight to the ladder not to hit her head on the side of the pool. Starting to loosen up a little, the tennis star started to grunt on each thrust the dolphin was giving her like she was trying to return an overpowering forehand. "HUH!...HUH!...HUH!...HUH!...HUH!..." It was starting to hurt the assaulted Russian even more as it was going deeper in, but she let it go on, overtaken by desire and excitement. With this position, it felt very different. The animal dick was so enormous that it was hitting bottom, pushing against her cervix. She was feeling the tip of its digging penis pressing against her womb entrance, trying to make room for all of his oversized sex tool. "Oooohh!!!", she exclaimed, then closed her eyes for a brief moment as she felt some slower thrusts inside her, as the drilling dolphin finally went all the way in. She had never been penetrated this deeply before and did not know she could. She could clearly feel it deep inside her lower abdomen now as she let herself be fucked by this huge animal now getting back its rhythm. Pain and pleasure were being mixed up as the energized marine lover fucked the famous tennis star ever so deep. Worried about its sheer size, she wasn't too sure if she should stop or continue. After thinking for a few seconds, pleasure was taking over pain so she just abandoned herself to her big sexual partner... "Ooooooohh...ow... ooh...oh just fuck me you big fishy...", she said as the big dolphin continued to ride its gorgeous willing blonde victim, strengthening each and every thrusts...Opening her eyes again, the abused young woman looked back, wanting to watch the big animal that was fucking her little body in a bestial raging manner. Observing the long body of the strong mammal humping her, she watched her firm ass being hit by the dolphin's lower body as its tail was forcing all of its huge pink penis inside her. At this moment, the board hunter came back and saw the poor girl almost out of sight, hidden by the large animal's body on top of its beautiful small human mate that was getting fucked by this huge beast. He wasn't too sure at first but then Anna stared at him with the most sexual look while she kept on being humped, moaning from pleasure... "Huh! Huh! Huh! Huh! Huh!", she went, in a fast series of high pitched moans as she was endlessly getting pounded from behind by the large dolphin. He watched the two of them brushing against each other, forming some kind of a perfect union. She looked at the stunned young man straight into his eyes as she started to be overwhelmed by her next orgasm. The coming girl started to shake and squirm as she was firmly holding the ladder bars. She closed her eyes for a brief moment and went: "Oooooooh! Oh, Steve...I think I am going to come...", as she started to lose control and stared straight back at Steve again. "Huuuuh!...Huuuuh!...Huuuuh!...", Anna was starting to climax as she looked at him...he couldn't believe how beautiful she was as she was reaching a wicked continuous orgasm... "Aaaah! Aaaah! Aaaah! Aaaaaaaah! " The blonde tennis star wasn't sure if it was just one strong climax or a series of multiple ones taking control of her ravished body... But then it was too much, she never had it so intense before... Trying to keep going, her body abandoned her will, aborting the penetration by the bending of her knees... "Oh my god! ohh.... aaaahh...", she exclaimed panting... The poor dolphin had not come yet, so it was still trying to copulate with her. After a brief moment, with her lowered body now deeper in the water, she could still feel its dick probing around as it tried to keep on fucking her, but its penis was closer to her ass! "Should I?", she thought...Oh screw trying to be rational! This was all the way now! Without another moment to spare, Anna arched her back to raise that beautiful round ass up, widening the gap between her soft and toned buttocks, exposing her waiting ass hole to the poking beast. After only a few seconds, its agile pointy tip found the small orifice and dug in between her parted ass cheeks. Feeling the dolphin's enormous dick starting to enter her ass hole, she had second thoughts for a moment; it was so big! But again, the insatiable Russian star was in horny mode...Besides, only the base is really wide....The animal then gave a few strong thrusts and bored inside her anal passage with its enormous spear shaped sexual organ. Then it started to hump, and boy did it hurt! "Aaah! Aaah!... oooh... oh no!... oh yes!...ow! oh my goood! ooh!...Oooh!...Oooh!" The helpless girl tried her best to relax her anal entry to ease the pain, only letting the aggressive marine mammal go deeper inside her ass. Inch after inch was going in on each thrust, the wider base of its oversized penis gradually stretching her anal entry to its limits, as the violated tennis star was screaming from her lungs. "AAAH!!!....AAAH!!!...AAAH!!!..."...After pushing his giant pink further inside her, the dolphin began pounding the vulnerable girl strongly as you could hear the sound of the bodies colliding, the water splashing everywhere. While the big mammal's body was slapping against Anna's beautiful ass making big splashes, Steve watched the anally intruded tennis star getting violently sodomized by the big dolphin as he came closer. The hurting girl looked up, reached out, seized one of his hands, and gripped it tightly as the big sea mammal continued to perform his anal sex, making its big penis disappear between her battered round buns. She grabbed the ladder again with a firm grip as it pressed on, humping her hard, she soon could feel the dolphin about to come in her tight ass. "Why am I enjoying this so much?!", she thought. "I am being sodomized by huge fish and I am loving it! This feels so good!" "Huh!...Huh!...Huh!...Huh!...Huh!..." The dolphin wasn't stopping, it seemed like it wanted to give its blonde human mate a ride to remember. It kept on humping and humping while the helpless blonde was grunting on every impaling thrusts. "Oh my god!..." Pleasure was taking over pain as her body was releasing large quantities of endorphin in her blood stream. It lasted at least a couple of minutes as it finally started to shudder as it was about to fill Anna's rear. She vigorously began rubbing her erect clitoris to try and come at the same time. "AAAH!!!...AAAH!!!" She was on the verge climaxing again as she could fell her ass about to get filled with dolphin cum. With six or seven thrusting convulsions, the dolphin started to release his love juice deep inside her rear end, arching its tail downwards to come into its blonde human sex partner as deep as it could. You could hear and feel the sea mammal's body slam against its blonde victim's round behind real hard on each orgasm contraction it was having. Steve watched as she was being pushed forward from the violent thrusts of the climaxing dolphin. "Aaaah!......Aaaah!......Aaaah!......Aaaah!.......", Anna and the dolphin were coming and she could feel it ejaculating its large amount of warm sperm deep inside her anal passage. Her entire body shuddered on each of its powerful thrusts as she was overcame by yet another tremendous orgasm. The famous tennis star was still amazed at how much she was loving this... She looked down again as it finished coming, took her right hand down and caressed the side of its powerful tail, feeling all of its strong muscles contract as it was giving its last ramming thrusts against her abused satin like behind; letting out cute highpitched little moans as the big dolphin released its remaining semen inside her pretty ass. She tried to catch her breath as the big creature then slowly detached from its blonde sexual partner, caressing her back with one of its flippers as it slowly pulled away. Steve kneeled in front of her to see if she was all right. "Are you ok?", he asked... "Yeah.... it hurts....", replied the exhausted little Anna as she laid her head on his knees, trying to wrap her arms around him. Steve just let the abused girl lay there in his lap, and caressed her head and hair... Suddenly they heard a crashing noise... "What was that???", asked the surprised girl as she got her head up. "I don't know but we better go I guess...It's getting late..." "Yeah, you're probably right..." Steve helped Anna out of the pool, then grabbed their things preparing to leave. "Damn where's my panties and stuff." She then heard one of the dolphins calling. There was one of them, right at the edge of the pool as it knew they were leaving. "Oh poor thing..." She wrapped a towel around her and went near the pool again kneeled down and kissed the sad dolphin... "We have to go... I promise I'll try and come back to see you...bye!..." The sea mammal had brought her underwear and tank top back to her. She couldn't believe it! "Oh! Thank you!", smiling at the dolphin... Her mind was racing about the whole experience, then got up as Steve closed everything down putting the mammal's back inside the holding tank and shutting the lights still not too sure about what made that noise. "Don't worry, I'll get you some clothes in the employees building...", said Steve. As they got there, Steve gave her a trainer's Marineland Tshirt for her to wear and walked towards the car...They went past the security guard that was sleeping in front of his TV. They sneaked out and walked towards Anna's car... "You drive Steve... I'm exhausted..." They both got in the car and drove towards home. Once on the highway, the famous young woman laid her head on his lap and said:"Thanks Steve...I can drop you off at your place. I'm leaving for Europe tomorrow morning for some promo stuff." Two minutes after, she fell asleep. Steve drove on as he held Anna sleeping on his lap... Arrived at his home they said their good byes, made him promise to not say anything and parted ways...Besides, who would believe that story! The next weekend, miss Kournikova's lawn employee went to her home to do his scheduled work but he knew she was still out of town. To his surprise, she had bought a brand new cool looking tractor mower. He smiled and went to mow the lawn with a big grin on his face... THE END
 

Beast Male - Extreme hardcore gay animalsex

hit counter code

animalsex\farmanalasiansbabysitterfarmersbabesbabysitter.htm

animalsex\farmanalbabessmallfarmsexbabesyoung.htm

animalsex\farmasiansbabysitterfarmkeeperasianspetite.htm

animalsex\farmasianspetitefarmfuckgirlspetite.htm

animalsex\farmbabesyoungfarmsexchickspetite.htm

animalsex\farmchicksyoungfarmfuckchicksbabysitter.htm

animalsex\farmersbabessmallfarmanalgirlspetite.htm

animalsex\farmersgirlspetitefarmerswomenbabysitter.htm

animalsex\farmersgirlspetitefarmerswomenyoung.htm

animalsex\farmersgirlspetitefarmerswomenbabysitter.htm

animalsex\farmersgirlspetitefarmerswomenyoung.htm

animalsex\farmersteenspetitefarmasianssmall.htm

animalsex\farmerswomenyoungfarmfuckteenspetite.htm

animalsex\farmasianspetitefarmfuckgirlspetite.htm

animalsex\farmfuckasianspetitefarmsexasianssmall.htm

animalsex\farmfuckteenspetitefarmersteensbabysitter.htm

animalsex\farmfuckwomensmallfarmasiansbabysitter.htm

animalsex\farmkeeperchicksbabysitterfarmteensyoung.htm

animalsex\farmkeeperwomenpetitefarmerschicksbabysitter.htm

animalsex\farmsexchickssmallfarmsexasiansbabysitter.htm

animalsex\farmkeeperwomenpetitefarmerschicksbabysitter.htm

animalsex\farmsexchickssmallfarmsexasiansbabysitter.htm

animalsex\FarmTeenGirls-.htm

animalsex\FarmTeenGirls_farmbabeoldfirm.htm

animalsex\FarmTeenGirls_farmbabeoldyoung.htm

animalsex\FarmTeenGirls_farmbabeteenspetite.htm

animalsex\FarmTeenGirls_farmchickteensyoung.htm

animalsex\FarmTeenGirls_farmfuckbabeoldsmall.htm

animalsex\FarmTeenGirls_farmfuckbabeteenagerssmall.htm

animalsex\FarmTeenGirls_farmfuckchickteenagerspetite.htm

animalsex\FarmTeenGirls_farmpasschickteenspetite.htm

animalsex\FarmTeenGirls_farmpassgirlsoldsmall.htm

animalsex\FarmTeenGirls_farmpasswomenoldsmall.htm

animalsex\FarmTeenGirls_farmsexchickoldfirm.htm

animalsex\FarmTeenGirls_farmsexgirlsmatureyoung.htm

animalsex\FarmTeenGirls-1.htm

animalsex\FarmTeenGirls-9.htm